"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A974CDL0"	"{'domain_architectures': 12942, 'entries': 4, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 12942}"	"['Modulator of macroautophagy that causes accumulation of autophagosomes under basal conditions and enhances autophagic flux. Represses cell death and promotes long-term clonogenic survival of cells grown in the absence of glucose in a macroautophagy-independent manner. May have some role in extracellular matrix engulfment or growth factor receptor recycling, both of which can modulate cell survival']"	"tmem150b.S"	""	"A0A974CDL0_XENLA"	"ab18c14a05b6d083e3b0fef65d3721398aa0f31f"	True	False	False	230	"CWH43-like N-terminal domain-containing protein"	3	""	"MWAWALLPICLTIWATAGIWIVYGMSVSNGSVNLSDGFPYISLCGTDPPQSCVFGQVLNVGAMLGVWISAIRFQQIRDYNCHSVLNSVSLAMGILCALGTSIVGNFQQSNQLETHLAGAFLAFVIGNIYFWMQTALTYMVKPTHGGCYIGPIRFCLSVACTALIVLMAVFLKMNMKSISAICEWIVAMILFLLYGLFAVDFWHLDGHYFHVKKRTVIPNEMQVSTVTLSI"	"unreviewed"	"{'taxId': '8355', 'scientificName': 'Xenopus laevis', 'fullName': 'Xenopus laevis (African clawed frog)'}"
