HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8X8BUU8",
"id": "A0A8X8BUU8_POLSE",
"source_organism": {
"taxId": "55291",
"scientificName": "Polypterus senegalus",
"fullName": "Polypterus senegalus (Senegal bichir)"
},
"name": "N-lysine methyltransferase SMYD2",
"description": [
"Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins, including p53/TP53 and RB1. Specifically trimethylates histone H3 'Lys-4' (H3K4me3) in vivo. The activity requires interaction with HSP90alpha. Shows even higher methyltransferase activity on p53/TP53. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates RB1 at 'Lys-860'"
],
"length": 434,
"sequence": "MKADGKAEGIERFISPGKGRGLRALKEFKVGDLVFMCPAYTYVLTVNERGNHCEFCFARKEGLSKCGKCKQAFYCNVNCQRGDWPMHKLECSSMCAFGENWNPSETVRLTARIIVKQKTQTEKTDSEKLLAVTEFESHLDKLDNEKKDLIQNDIAALHHFYSKHLEYPDNASLVTLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYRGTLAEVRAVQPISPGDEIFTSYIDLLYPTEDRNDRLKDSYFFSCECKECTTKEKDKAKLEIRKMNEPPKQEAVKEMIKYARNVIEEFRRAKHYKTPSELLEICELSLDKMGAVFEDSNVYMLHMMYQAMGVCLYMQDWEGAMRYGEKIIKPYSKHYPAYSLNVASMWLKLGRLYIGLEKKSLGVKALKKAIAIMEVAHGKDHHYIAEVKKELDEH",
"proteome": "UP000886611",
"gene": "Smyd2",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016279",
"name": "protein-lysine N-methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042054",
"name": "histone methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cdb0e2dff944ca9f12bf7c5f8bce1b4131c3a44b",
"counters": {
"domain_architectures": 6599,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 2,
"smart": 1,
"cdd": 1,
"ssf": 2,
"cathgene3d": 5,
"pfam": 2,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6599
}
}
}