GET /api/protein/UniProt/A0A8X8BUU8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8X8BUU8",
        "id": "A0A8X8BUU8_POLSE",
        "source_organism": {
            "taxId": "55291",
            "scientificName": "Polypterus senegalus",
            "fullName": "Polypterus senegalus (Senegal bichir)"
        },
        "name": "N-lysine methyltransferase SMYD2",
        "description": [
            "Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins, including p53/TP53 and RB1. Specifically trimethylates histone H3 'Lys-4' (H3K4me3) in vivo. The activity requires interaction with HSP90alpha. Shows even higher methyltransferase activity on p53/TP53. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates RB1 at 'Lys-860'"
        ],
        "length": 434,
        "sequence": "MKADGKAEGIERFISPGKGRGLRALKEFKVGDLVFMCPAYTYVLTVNERGNHCEFCFARKEGLSKCGKCKQAFYCNVNCQRGDWPMHKLECSSMCAFGENWNPSETVRLTARIIVKQKTQTEKTDSEKLLAVTEFESHLDKLDNEKKDLIQNDIAALHHFYSKHLEYPDNASLVTLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYRGTLAEVRAVQPISPGDEIFTSYIDLLYPTEDRNDRLKDSYFFSCECKECTTKEKDKAKLEIRKMNEPPKQEAVKEMIKYARNVIEEFRRAKHYKTPSELLEICELSLDKMGAVFEDSNVYMLHMMYQAMGVCLYMQDWEGAMRYGEKIIKPYSKHYPAYSLNVASMWLKLGRLYIGLEKKSLGVKALKKAIAIMEVAHGKDHHYIAEVKKELDEH",
        "proteome": "UP000886611",
        "gene": "Smyd2",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016279",
                "name": "protein-lysine N-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042054",
                "name": "histone methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cdb0e2dff944ca9f12bf7c5f8bce1b4131c3a44b",
        "counters": {
            "domain_architectures": 6599,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "smart": 1,
                "cdd": 1,
                "ssf": 2,
                "cathgene3d": 5,
                "pfam": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6599
        }
    }
}