HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8U1F249",
"id": "A0A8U1F249_SALNM",
"source_organism": {
"taxId": "8040",
"scientificName": "Salvelinus namaycush",
"fullName": "Salvelinus namaycush (Lake trout)"
},
"name": "F-box domain-containing protein",
"description": [
"Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins: the interaction with substrates requires the phosphorylation of the two serine residues in the substrates' destruction motif D-S-G-X(2,3,4)-S. SCF(FBXW11) mediates the ubiquitination of phosphorylated CTNNB1 and participates in Wnt signaling regulation. Participates in Wnt signaling regulation, and plays a role in eye and jaw development. SCF(FBXW11) plays a key role in NF-kappa-B activation by mediating ubiquitination of phosphorylated NFKBIA, leading to its degradation by the proteasome, thereby allowing the associated NF-kappa-B complex to translocate into the nucleus and to activate transcription"
],
"length": 527,
"sequence": "MEPEMEDNTLELMNTSVMESQNHVDDLSPKKTTILTKFSNGPVMTGSRKRPSEGNCDKEQCIALFDQWSETDQVEFVEHLISHMCHYQHGHINTYLKPMLQRDFITALPAQGLDHIAENILSFLDAQSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRTTEVPPNSYYHSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVTSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQSEGRSPSRTYTYISR",
"proteome": "UP000808372",
"gene": "LOC120062303",
"go_terms": [
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e4853a01753e4898f98eb9e3c854a1bff495839d",
"counters": {
"domain_architectures": 3390,
"entries": 28,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"smart": 3,
"pfam": 3,
"ssf": 2,
"cdd": 2,
"profile": 3,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3390
}
}
}