General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8U1F249",
        "id": "A0A8U1F249_SALNM",
        "source_organism": {
            "taxId": "8040",
            "scientificName": "Salvelinus namaycush",
            "fullName": "Salvelinus namaycush (Lake trout)"
        },
        "name": "F-box domain-containing protein",
        "description": [
            "Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins: the interaction with substrates requires the phosphorylation of the two serine residues in the substrates' destruction motif D-S-G-X(2,3,4)-S. SCF(FBXW11) mediates the ubiquitination of phosphorylated CTNNB1 and participates in Wnt signaling regulation. Participates in Wnt signaling regulation, and plays a role in eye and jaw development. SCF(FBXW11) plays a key role in NF-kappa-B activation by mediating ubiquitination of phosphorylated NFKBIA, leading to its degradation by the proteasome, thereby allowing the associated NF-kappa-B complex to translocate into the nucleus and to activate transcription"
        ],
        "length": 527,
        "sequence": "MEPEMEDNTLELMNTSVMESQNHVDDLSPKKTTILTKFSNGPVMTGSRKRPSEGNCDKEQCIALFDQWSETDQVEFVEHLISHMCHYQHGHINTYLKPMLQRDFITALPAQGLDHIAENILSFLDAQSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRTTEVPPNSYYHSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVTSGEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQSEGRSPSRTYTYISR",
        "proteome": "UP000808372",
        "gene": "LOC120062303",
        "go_terms": [
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e4853a01753e4898f98eb9e3c854a1bff495839d",
        "counters": {
            "domain_architectures": 3390,
            "entries": 28,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "smart": 3,
                "pfam": 3,
                "ssf": 2,
                "cdd": 2,
                "profile": 3,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3390
        }
    }
}