General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8U0R8A1",
        "id": "A0A8U0R8A1_MUSPF",
        "source_organism": {
            "taxId": "9669",
            "scientificName": "Mustela putorius furo",
            "fullName": "Mustela putorius furo (European domestic ferret)"
        },
        "name": "Caspase-9",
        "description": [
            "Involved in the activation cascade of caspases responsible for apoptosis execution. Binding of caspase-9 to Apaf-1 leads to activation of the protease which then cleaves and activates effector caspases caspase-3 (CASP3) or caspase-7 (CASP7). Promotes DNA damage-induced apoptosis in a ABL1/c-Abl-dependent manner. Proteolytically cleaves poly(ADP-ribose) polymerase (PARP). Cleaves BIRC6 following inhibition of BIRC6-caspase binding by DIABLO/SMAC"
        ],
        "length": 437,
        "sequence": "MDEADRQILRRCRVQLVNELQVAPLWDVLLTRQLFTPAMIEDIQHAGSGSRSDQARQLVIDLETRGSQALPLFISCLEDTDQNKLASVLRALRQAEKQNPEVIRPQDPMPVVVRALGLTPEDLRGKQGPSKATPGKLAPVVLGPEQLWPAKLRPEVLRPEMPRPVDSGSGRFSDVCAPEISKQNADLAYALNADPCGHCLIINNVNFCLESRLTARTGSNIDCEKLRQRFHLLHFMVEVKCDLTAKQMVQALVELARRDHSALDCCVVVVLSHGCQASHLQFPGAVYGTDGCPVAIERIVNIFNGAGCPSLGGKPKLFFIQACGGEQKDHGFEVASASPEDRTPGSDPESDAVPFQEGPGPCDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDTKSGSWYVETLDGVFEQWAHSEDLQTLLLRLRYGSSPSVHPQMRG",
        "proteome": "UP000000715",
        "gene": "CASP9",
        "go_terms": [
            {
                "identifier": "GO:0042981",
                "name": "regulation of apoptotic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008234",
                "name": "cysteine-type peptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004197",
                "name": "cysteine-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5fe924bb2ee96ddea1d8c53ee09651e2b64e5aea",
        "counters": {
            "domain_architectures": 3445,
            "entries": 29,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "smart": 2,
                "profile": 3,
                "cathgene3d": 2,
                "cdd": 2,
                "pfam": 2,
                "pirsf": 1,
                "panther": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 11
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3445
        }
    }
}