HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8U0MQD4",
"id": "A0A8U0MQD4_MUSPF",
"source_organism": {
"taxId": "9669",
"scientificName": "Mustela putorius furo",
"fullName": "Mustela putorius furo (European domestic ferret)"
},
"name": "Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase",
"description": [
"Acts as a negative regulator of entry into mitosis (G2 to M transition) by phosphorylation of the CDK1 kinase specifically when CDK1 is complexed to cyclins. Mediates phosphorylation of CDK1 predominantly on 'Thr-14'. Also involved in Golgi fragmentation. May be involved in phosphorylation of CDK1 on 'Tyr-15' to a lesser degree, however tyrosine kinase activity is unclear and may be indirect"
],
"length": 493,
"sequence": "MPVPTEGTPPRLSGTPVPVPAYFRHAEPGFSLKRPGGLSRSLPPRPPAKGSIPVSRLFPPRTPGWHQPQPRRVSFRSKASETLQSPSYDPSRPESFFQQSFQRLGRLGHGSYGEVFKVRSKEDGRLYAIKRSMSPFRGPKDRARKLAEVGGHEKVGQHPRCVRLEQAWEEGGILYLQTELCGPSLQQHSEAWGTGLPEAQVWGYLRDTLLALAHLHGQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTSGAGEAQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLTMMLEPDPKLRATASALLALPMLRRPRPWSVLWYVAADALSRGWALWQALLSLLCWLWHGLAHPASWLQPPSPPATPPGSPPCSLLLHSSLSSSWDDDSVGLSLSPEAVLARAAGNTSTPRNGSPAPRNRDALDLSDIDSEPPRGSFPAFEPRNLLSLFEDSLGPT",
"proteome": "UP000000715",
"gene": "PKMYT1",
"go_terms": [
{
"identifier": "GO:0004672",
"name": "protein kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006468",
"name": "protein phosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "726173b0dde7bbc50c5d845a39c992d18faf18f3",
"counters": {
"domain_architectures": 887312,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"smart": 1,
"profile": 1,
"panther": 1,
"prosite": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 887312
}
}
}