GET /api/protein/UniProt/A0A8T1VDY5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8T1VDY5",
        "id": "A0A8T1VDY5_9STRA",
        "source_organism": {
            "taxId": "221518",
            "scientificName": "Phytophthora pseudosyringae",
            "fullName": "Phytophthora pseudosyringae"
        },
        "name": "Endonuclease III homolog",
        "description": [
            "Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines"
        ],
        "length": 351,
        "sequence": "MRSILARPSLRRIASSSLTDPVATTLGGMRLRSSGPVDGDTSLEKKAMAMKLEGGHPPSPLRPARRRHSGKTEDENVGIKREKAERTEEETLRTPKKKAKKAAVKKERVPRKEPEGWKEILRGIEEMRAKKDAEVDKYGCEVFFDESFPPQVCRFHVLIAAMMSSQTKDPVNAAAMGRLIKRGLTVESMLEIDQQELAQLIRPVGFFNHKAKYIKQTASILTKQAEAEGKEDVDIPNTYEGLIALPGVGPKMATLVMNCAWNNTVGICVDTHVHRISNRLKWVKTWNKNNPKSQNPEKTRTELEDWLPKEHWGPINPLLVGFGQTICLPRGPKCNDCKIRGSCPSANSSAI",
        "proteome": "UP000694044",
        "gene": "NTHL1_3",
        "go_terms": [
            {
                "identifier": "GO:0006284",
                "name": "base-excision repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003906",
                "name": "DNA-(apurinic or apyrimidinic site) endonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019104",
                "name": "DNA N-glycosylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006285",
                "name": "base-excision repair, AP site formation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ddd5072a1223698000690500e0e6a81f15308649",
        "counters": {
            "domain_architectures": 16761,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "pfam": 2,
                "smart": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 16761
        }
    }
}