GET /api/protein/UniProt/A0A8J1JMY0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8J1JMY0",
        "id": "A0A8J1JMY0_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "D-ribitol-5-phosphate cytidylyltransferase",
        "description": [
            "Cytidylyltransferase required for protein O-linked mannosylation. Catalyzes the formation of CDP-ribitol nucleotide sugar from D-ribitol 5-phosphate. CDP-ribitol is a substrate of FKTN during the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity. Shows activity toward other pentose phosphate sugars and mediates formation of CDP-ribulose or CDP-ribose using CTP and ribulose-5-phosphate or ribose-5-phosphate, respectively. Not involved in dolichol production"
        ],
        "length": 344,
        "sequence": "MKAIIHKYGHQRVTLVKGGETRHRSIFNGLKVFSENHSDDTAIDKPEVVIIHDAVRPFVDEDFLLQVAKSAKQHGAAGAIRPLVSTVIASSSDGFLDYSLERARHRASEMPQAFQYDVIYRAYLQCTDYDLDFGTECLHLALQYSNVKAKLLEGPPDLWKVTYKRDLYAAESVIKESISQQLCIVTNVKKEAIEVGFLLHENLKLHYKQVKAVSSSMCKTIHHLQNIFHGQCCNFICINVKDLDFEETQNLVDLLQTTNASISYPLVIVSVHLTTEDSSSGNKLSGVRKLAKEAHKSNILVYGLLINIDQDKVQLQQTVCEGTAIITALIKDRNPALVGQLMVA",
        "proteome": "UP000008143",
        "gene": "crppa",
        "go_terms": [
            {
                "identifier": "GO:0070567",
                "name": "cytidylyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008299",
                "name": "isoprenoid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f900ad3d220e7dd429bad9a01e037b72bc5d1fe5",
        "counters": {
            "domain_architectures": 945,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 945
        }
    }
}