GET /api/protein/UniProt/A0A8J0T5E5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8J0T5E5",
"id": "A0A8J0T5E5_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "Nucleolysin TIAR",
"description": [
"RNA-binding protein involved in alternative pre-RNA splicing and in cytoplasmic stress granules formation. Shows a preference for uridine-rich RNAs. Activates splicing of alternative exons with weak 5' splice sites followed by a U-rich stretch on its own pre-mRNA and on TIA1 mRNA. Promotes the inclusion of TIA1 exon 5 to give rise to the long isoform (isoform a) of TIA1. Acts downstream of the stress-induced phosphorylation of EIF2S1/EIF2A to promote the recruitment of untranslated mRNAs to cytoplasmic stress granules (SG). Possesses nucleolytic activity against cytotoxic lymphocyte target cells. May be involved in apoptosis"
],
"length": 445,
"sequence": "MSGFSLTGYWPLPPFCFEPDGVRQDLLFAPVLRPSPPPPPCPLTHFPLENPGSPTDMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQTDGRRVGASVSFPVLPNANNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATSKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFDDVVNQSSAKNCTVYCGGIGSGLTEQLMRQTFGVFGQILEIRVFPEKGYSFIRFSTHDSAAHAIVSVNGTTIEGHVVKCYWGKETPDMTKNFQQVDYSQWGQWGQMYGSPQQYGQYVTNGWQVPSYGVYGQAWNQQSFGVDQSPSTAWVGGFSAQPPPQGQAPPVIPNPPGYSMASYQTQ",
"proteome": "UP000186698",
"gene": "tial1.S",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1d8d02f5f54dae87c0a5dfa9c17a8ccb9f1ee753",
"counters": {
"domain_architectures": 50304,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"smart": 2,
"cdd": 3,
"pfam": 1,
"panther": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 50304
}
}
}