GET /api/protein/UniProt/A0A8J0T5E5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8J0T5E5",
        "id": "A0A8J0T5E5_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Nucleolysin TIAR",
        "description": [
            "RNA-binding protein involved in alternative pre-RNA splicing and in cytoplasmic stress granules formation. Shows a preference for uridine-rich RNAs. Activates splicing of alternative exons with weak 5' splice sites followed by a U-rich stretch on its own pre-mRNA and on TIA1 mRNA. Promotes the inclusion of TIA1 exon 5 to give rise to the long isoform (isoform a) of TIA1. Acts downstream of the stress-induced phosphorylation of EIF2S1/EIF2A to promote the recruitment of untranslated mRNAs to cytoplasmic stress granules (SG). Possesses nucleolytic activity against cytotoxic lymphocyte target cells. May be involved in apoptosis"
        ],
        "length": 445,
        "sequence": "MSGFSLTGYWPLPPFCFEPDGVRQDLLFAPVLRPSPPPPPCPLTHFPLENPGSPTDMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQTDGRRVGASVSFPVLPNANNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATSKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFDDVVNQSSAKNCTVYCGGIGSGLTEQLMRQTFGVFGQILEIRVFPEKGYSFIRFSTHDSAAHAIVSVNGTTIEGHVVKCYWGKETPDMTKNFQQVDYSQWGQWGQMYGSPQQYGQYVTNGWQVPSYGVYGQAWNQQSFGVDQSPSTAWVGGFSAQPPPQGQAPPVIPNPPGYSMASYQTQ",
        "proteome": "UP000186698",
        "gene": "tial1.S",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1d8d02f5f54dae87c0a5dfa9c17a8ccb9f1ee753",
        "counters": {
            "domain_architectures": 50304,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "smart": 2,
                "cdd": 3,
                "pfam": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 50304
        }
    }
}