General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8I5ZX76",
        "id": "A0A8I5ZX76_RAT",
        "source_organism": {
            "taxId": "10116",
            "scientificName": "Rattus norvegicus",
            "fullName": "Rattus norvegicus (Rat)"
        },
        "name": "Eukaryotic translation initiation factor 3 subunit K",
        "description": [
            "Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression"
        ],
        "length": 218,
        "sequence": "MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDNQLRVWMSKYGWSADESGQVFICSQEESIKPKNIVEKIDFDSVSSIMASSQ",
        "proteome": "UP000002494",
        "gene": "Eif3k",
        "go_terms": [
            {
                "identifier": "GO:0003743",
                "name": "translation initiation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043022",
                "name": "ribosome binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006446",
                "name": "regulation of translational initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005852",
                "name": "eukaryotic translation initiation factor 3 complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0f21178934646dc825a7ffdf8ebd8a66ab66968f",
        "counters": {
            "domain_architectures": 11359,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "profile": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11359
        }
    }
}