GET /api/protein/UniProt/A0A8D2EVQ3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8D2EVQ3",
"id": "A0A8D2EVQ3_THEGE",
"source_organism": {
"taxId": "9565",
"scientificName": "Theropithecus gelada",
"fullName": "Theropithecus gelada (Gelada baboon)"
},
"name": "Non-histone chromosomal protein HMG-17",
"description": [
"Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation"
],
"length": 90,
"sequence": "MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPDPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK",
"proteome": "UP000694411",
"gene": null,
"go_terms": [
{
"identifier": "GO:0031492",
"name": "nucleosomal DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000785",
"name": "chromatin",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1eb55ce16369c00ec3ab43dd2b8342203ecc4f39",
"counters": {
"domain_architectures": 4904,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"prints": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4904
}
}
}