"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8D2EVQ3"	"{'domain_architectures': 4904, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'panther': 1, 'pfam': 1, 'prosite': 1, 'prints': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4904}"	"['Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation']"	""	"[{'identifier': 'GO:0031492', 'name': 'nucleosomal DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000785', 'name': 'chromatin', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005634', 'name': 'nucleus', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A8D2EVQ3_THEGE"	"1eb55ce16369c00ec3ab43dd2b8342203ecc4f39"	True	False	False	90	"Non-histone chromosomal protein HMG-17"	3	"UP000694411"	"MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPDPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK"	"unreviewed"	"{'taxId': '9565', 'scientificName': 'Theropithecus gelada', 'fullName': 'Theropithecus gelada (Gelada baboon)'}"