GET /api/protein/UniProt/A0A8C9DX11/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C9DX11",
"id": "A0A8C9DX11_PHOSS",
"source_organism": {
"taxId": "42100",
"scientificName": "Phocoena sinus",
"fullName": "Phocoena sinus (Vaquita)"
},
"name": "Protein S100",
"description": [
"May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative"
],
"length": 90,
"sequence": "MACPLDQAIGLLVTIFHKYSSQEGDKNTLSKSELKELIQKELTIGAKLQDAEIAKLMDDLDRNKDQVVNFQEYVTFLGALAMIYNDILRG",
"proteome": "UP000694554",
"gene": "S100A6",
"go_terms": [
{
"identifier": "GO:0005509",
"name": "calcium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9fbe415715d177c71b45cd24325edde000517727",
"counters": {
"domain_architectures": 10240,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 1,
"pfam": 1,
"smart": 2,
"ssf": 1,
"profile": 1,
"panther": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10240
}
}
}