"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8C9DX11"	"{'domain_architectures': 9687, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'cathgene3d': 1, 'pfam': 1, 'smart': 2, 'ssf': 1, 'profile': 1, 'panther': 1, 'prosite': 2, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 9687}"	"['May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative']"	"S100A6"	"[{'identifier': 'GO:0005509', 'name': 'calcium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A8C9DX11_PHOSS"	"9fbe415715d177c71b45cd24325edde000517727"	True	False	90	"Protein S100"	3	"UP000694554"	"MACPLDQAIGLLVTIFHKYSSQEGDKNTLSKSELKELIQKELTIGAKLQDAEIAKLMDDLDRNKDQVVNFQEYVTFLGALAMIYNDILRG"	"unreviewed"	"{'taxId': '42100', 'scientificName': 'Phocoena sinus', 'fullName': 'Phocoena sinus (Vaquita)'}"
