General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C6YY91",
        "id": "A0A8C6YY91_NOTPE",
        "source_organism": {
            "taxId": "30464",
            "scientificName": "Nothoprocta perdicaria",
            "fullName": "Nothoprocta perdicaria (Chilean tinamou)"
        },
        "name": "Cytosolic iron-sulfur assembly component 2B",
        "description": [
            "Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins. As a CIA complex component and in collaboration with CIAO1 and MMS19, binds to and facilitates the assembly of most cytosolic-nuclear Fe/S proteins. As part of the mitotic spindle-associated MMXD complex it plays a role in chromosome segregation, probably by facilitating iron-sulfur cluster assembly into ERCC2/XPD. Together with MMS19, facilitates the transfer of Fe-S clusters to the motor protein KIF4A, which ensures proper localization of KIF4A to mitotic machinery components to promote the progression of mitosis"
        ],
        "length": 132,
        "sequence": "MYHYIEKSDYMLNMTLSYLRYPAGDGGGAGPGWVGPGVAGLGRTGAGSAARFLSLAHLIRSINDPEHPLTLEELNVVELPCPQVNDAESTVSVAFTPTIPHCSMATLIGLSIKVKLIRSLPERKYDSVPQLW",
        "proteome": "UP000694420",
        "gene": "CIAO2B",
        "go_terms": [
            {
                "identifier": "GO:0051604",
                "name": "protein maturation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "862be6dc5f81929a4299943344f85a047aaa221e",
        "counters": {
            "domain_architectures": 22802,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22802
        }
    }
}