"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8C6YY91"	"{'domain_architectures': 18333, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 18333}"	"['Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins. As a CIA complex component and in collaboration with CIAO1 and MMS19, binds to and facilitates the assembly of most cytosolic-nuclear Fe/S proteins. As part of the mitotic spindle-associated MMXD complex it plays a role in chromosome segregation, probably by facilitating iron-sulfur cluster assembly into ERCC2/XPD. Together with MMS19, facilitates the transfer of Fe-S clusters to the motor protein KIF4A, which ensures proper localization of KIF4A to mitotic machinery components to promote the progression of mitosis']"	"CIAO2B"	"[{'identifier': 'GO:0051604', 'name': 'protein maturation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A8C6YY91_NOTPE"	"862be6dc5f81929a4299943344f85a047aaa221e"	True	False	132	"Cytosolic iron-sulfur assembly component 2B"	3	"UP000694420"	"MYHYIEKSDYMLNMTLSYLRYPAGDGGGAGPGWVGPGVAGLGRTGAGSAARFLSLAHLIRSINDPEHPLTLEELNVVELPCPQVNDAESTVSVAFTPTIPHCSMATLIGLSIKVKLIRSLPERKYDSVPQLW"	"unreviewed"	"{'taxId': '30464', 'scientificName': 'Nothoprocta perdicaria', 'fullName': 'Nothoprocta perdicaria (Chilean tinamou)'}"