GET /api/protein/UniProt/A0A8C6CDC4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C6CDC4",
        "id": "A0A8C6CDC4_MONMO",
        "source_organism": {
            "taxId": "40151",
            "scientificName": "Monodon monoceros",
            "fullName": "Monodon monoceros (Narwhal)"
        },
        "name": "Matrix Gla protein",
        "description": [
            "Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation"
        ],
        "length": 103,
        "sequence": "MRSLLLLSILAALAVAALCYESHESMESYEINPFINRRNANIFISPQQRWRVKAQERIREHSKPAYEINREACDDFKLCERYALVYGYNAAYNRYFRQRPGAK",
        "proteome": "UP000694561",
        "gene": "MGP",
        "go_terms": [
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0031012",
                "name": "extracellular matrix",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0030500",
                "name": "regulation of bone mineralization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ff2ad09b7fd43b3470f477febf99c4d31e89665f",
        "counters": {
            "domain_architectures": 1995,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1995
        }
    }
}