"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8C6CDC4"	"{'domain_architectures': 1995, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'ssf': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1995}"	"['Associates with the organic matrix of bone and cartilage. Thought to act as an inhibitor of bone formation']"	"MGP"	"[{'identifier': 'GO:0005509', 'name': 'calcium ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0031012', 'name': 'extracellular matrix', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0030500', 'name': 'regulation of bone mineralization', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A8C6CDC4_MONMO"	"ff2ad09b7fd43b3470f477febf99c4d31e89665f"	True	False	False	103	"Matrix Gla protein"	3	"UP000694561"	"MRSLLLLSILAALAVAALCYESHESMESYEINPFINRRNANIFISPQQRWRVKAQERIREHSKPAYEINREACDDFKLCERYALVYGYNAAYNRYFRQRPGAK"	"unreviewed"	"{'taxId': '40151', 'scientificName': 'Monodon monoceros', 'fullName': 'Monodon monoceros (Narwhal)'}"