HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8C6AMA9",
"id": "A0A8C6AMA9_MONMO",
"source_organism": {
"taxId": "40151",
"scientificName": "Monodon monoceros",
"fullName": "Monodon monoceros (Narwhal)"
},
"name": "NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial",
"description": [
"Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity of complex I"
],
"length": 216,
"sequence": "MAALAAPGLLRGILALRSGMGAALQVRGVHPSLAADSPSSTHPAVSQAGAVVPKSAALPSSRGEYVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLQIWYRR",
"proteome": "UP000694561",
"gene": "NDUFS7",
"go_terms": [
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008137",
"name": "NADH dehydrogenase (ubiquinone) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0048038",
"name": "quinone binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ec2bdf213efa2e994a9300f4d128e854c4d858c2",
"counters": {
"domain_architectures": 44517,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 2,
"prosite": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 44517
}
}
}