"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8C6AMA9"	"{'domain_architectures': 44517, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 2, 'prosite': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 44517}"	"['Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity of complex I']"	"NDUFS7"	"[{'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0048038', 'name': 'quinone binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A8C6AMA9_MONMO"	"ec2bdf213efa2e994a9300f4d128e854c4d858c2"	True	False	False	216	"NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial"	3	"UP000694561"	"MAALAAPGLLRGILALRSGMGAALQVRGVHPSLAADSPSSTHPAVSQAGAVVPKSAALPSSRGEYVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQKKIKREKRLQIWYRR"	"unreviewed"	"{'taxId': '40151', 'scientificName': 'Monodon monoceros', 'fullName': 'Monodon monoceros (Narwhal)'}"