General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8C2WHV2",
        "id": "A0A8C2WHV2_CYCLU",
        "source_organism": {
            "taxId": "8103",
            "scientificName": "Cyclopterus lumpus",
            "fullName": "Cyclopterus lumpus (Lumpsucker)"
        },
        "name": "Reactive oxygen species modulator 1",
        "description": [
            "Has antibacterial activity against a variety of bacteria including S.aureus, P.aeruginosa and M.tuberculosis. Acts by inducing bacterial membrane breakage",
            "Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation"
        ],
        "length": 79,
        "sequence": "MPVAVGPYGQTQPSCFDRVKMGFMMGFAVGMAAGAMFGTFSCLRVGMRGRELMGGVGKTMMQSGGTFGTFMSIGMGIRC",
        "proteome": "UP000694565",
        "gene": "romo1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "57bc9ff14bf07571fa142751c454b277fd2e6d3a",
        "counters": {
            "domain_architectures": 3455,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3455
        }
    }
}