"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8C2WHV2"	"{'domain_architectures': 3455, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3455}"	"['Has antibacterial activity against a variety of bacteria including S.aureus, P.aeruginosa and M.tuberculosis. Acts by inducing bacterial membrane breakage', 'Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation']"	"romo1"	""	"A0A8C2WHV2_CYCLU"	"57bc9ff14bf07571fa142751c454b277fd2e6d3a"	True	False	False	79	"Reactive oxygen species modulator 1"	3	"UP000694565"	"MPVAVGPYGQTQPSCFDRVKMGFMMGFAVGMAAGAMFGTFSCLRVGMRGRELMGGVGKTMMQSGGTFGTFMSIGMGIRC"	"unreviewed"	"{'taxId': '8103', 'scientificName': 'Cyclopterus lumpus', 'fullName': 'Cyclopterus lumpus (Lumpsucker)'}"