GET /api/protein/UniProt/A0A8B9EXM3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B9EXM3",
"id": "A0A8B9EXM3_ANSCY",
"source_organism": {
"taxId": "8845",
"scientificName": "Anser cygnoides",
"fullName": "Anser cygnoides (Swan goose)"
},
"name": "Tissue factor pathway inhibitor 2",
"description": [
"May play a role in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. Has no effect on thrombin"
],
"length": 226,
"sequence": "MAAGRRLPLPALLLPLACAALAPQKQRACLLPPDDGPCRALVPRWYYDRYTQSCQEFTYGGCHGNANNFLTLDDCEKSCWTIKKVPKLCRMEADGGPCRGHLKRYAFNLSSMRCEEFIYGGCYGNGNNFRDLQSCVDHCLPEKSNGSGPLLCYSPKDEGLCSSSVPRYYYDTKSKSCKEFKYTGCGGNANNFVTETDCYNVCGKGKFFFFFLYFIRRKQINQSRSQ",
"proteome": "UP000694521",
"gene": null,
"go_terms": [
{
"identifier": "GO:0004867",
"name": "serine-type endopeptidase inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "da1dbef7474dfb931949807831ef35abc3444b1c",
"counters": {
"domain_architectures": 2221,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 3,
"smart": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2221
}
}
}