"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8B9EXM3"	"{'domain_architectures': 2040, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 3, 'smart': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2040}"	"['May play a role in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. Has no effect on thrombin']"	""	"[{'identifier': 'GO:0004867', 'name': 'serine-type endopeptidase inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A8B9EXM3_ANSCY"	"da1dbef7474dfb931949807831ef35abc3444b1c"	True	False	226	"Tissue factor pathway inhibitor 2"	4	"UP000694521"	"MAAGRRLPLPALLLPLACAALAPQKQRACLLPPDDGPCRALVPRWYYDRYTQSCQEFTYGGCHGNANNFLTLDDCEKSCWTIKKVPKLCRMEADGGPCRGHLKRYAFNLSSMRCEEFIYGGCYGNGNNFRDLQSCVDHCLPEKSNGSGPLLCYSPKDEGLCSSSVPRYYYDTKSKSCKEFKYTGCGGNANNFVTETDCYNVCGKGKFFFFFLYFIRRKQINQSRSQ"	"unreviewed"	"{'taxId': '8845', 'scientificName': 'Anser cygnoides', 'fullName': 'Anser cygnoides (Swan goose)'}"