GET /api/protein/UniProt/A0A8B8W4I6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B8W4I6",
        "id": "A0A8B8W4I6_BALMU",
        "source_organism": {
            "taxId": "9771",
            "scientificName": "Balaenoptera musculus",
            "fullName": "Balaenoptera musculus (Blue whale)"
        },
        "name": "Prostaglandin E synthase 3",
        "description": [
            "Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation"
        ],
        "length": 153,
        "sequence": "MARQHARTLWYDRPKYVFMEFCVEDSTDVHVLIEDHRIVFSCKNADGVEFYNEIEFYAKVNCKDSQDKCSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLCVDFDNWRDWEGDEEVELAQVDHYAELLEKVSTKRPPPAMDDLDALDYGCCVR",
        "proteome": "UP000694857",
        "gene": "PTGES3L",
        "go_terms": [
            {
                "identifier": "GO:0051879",
                "name": "Hsp90 protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cb338d00b2b04faff362433fd5074de637eeb145",
        "counters": {
            "domain_architectures": 17059,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17059
        }
    }
}