GET /api/protein/UniProt/A0A8B8W4I6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A8B8W4I6",
"id": "A0A8B8W4I6_BALMU",
"source_organism": {
"taxId": "9771",
"scientificName": "Balaenoptera musculus",
"fullName": "Balaenoptera musculus (Blue whale)"
},
"name": "Prostaglandin E synthase 3",
"description": [
"Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation"
],
"length": 153,
"sequence": "MARQHARTLWYDRPKYVFMEFCVEDSTDVHVLIEDHRIVFSCKNADGVEFYNEIEFYAKVNCKDSQDKCSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLCVDFDNWRDWEGDEEVELAQVDHYAELLEKVSTKRPPPAMDDLDALDYGCCVR",
"proteome": "UP000694857",
"gene": "PTGES3L",
"go_terms": [
{
"identifier": "GO:0051879",
"name": "Hsp90 protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cb338d00b2b04faff362433fd5074de637eeb145",
"counters": {
"domain_architectures": 17059,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17059
}
}
}