GET /api/protein/UniProt/A0A8B7RVI3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A8B7RVI3",
        "id": "A0A8B7RVI3_HIPAR",
        "source_organism": {
            "taxId": "186990",
            "scientificName": "Hipposideros armiger",
            "fullName": "Hipposideros armiger (Great Himalayan leaf-nosed bat)"
        },
        "name": "Small nuclear ribonucleoprotein E",
        "description": [
            "Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs. As part of the U7 snRNP it is involved in histone 3'-end processing"
        ],
        "length": 92,
        "sequence": "MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN",
        "proteome": "UP000694851",
        "gene": "SNRPE",
        "go_terms": [
            {
                "identifier": "GO:0000398",
                "name": "mRNA splicing, via spliceosome",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005681",
                "name": "spliceosomal complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "83b18cf71a575d59c0de6840812ffe7912383fc4",
        "counters": {
            "domain_architectures": 70645,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 70645
        }
    }
}