"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A8B7RVI3"	"{'domain_architectures': 61465, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'profile': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 61465}"	"[""Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs. As part of the U7 snRNP it is involved in histone 3'-end processing""]"	"SNRPE"	"[{'identifier': 'GO:0000398', 'name': 'mRNA splicing, via spliceosome', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005681', 'name': 'spliceosomal complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A8B7RVI3_HIPAR"	"83b18cf71a575d59c0de6840812ffe7912383fc4"	True	False	92	"Small nuclear ribonucleoprotein E"	3	"UP000694851"	"MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN"	"unreviewed"	"{'taxId': '186990', 'scientificName': 'Hipposideros armiger', 'fullName': 'Hipposideros armiger (Great Himalayan leaf-nosed bat)'}"
