GET /api/protein/UniProt/A0A836FP47/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A836FP47",
"id": "A0A836FP47_9HYME",
"source_organism": {
"taxId": "230685",
"scientificName": "Acromyrmex heyeri",
"fullName": "Acromyrmex heyeri"
},
"name": "DET1- and DDB1-associated protein 1",
"description": [
"Functions as a component of numerous distinct DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. In the DCX complexes, acts as a scaffolding subunit required to stabilize the complex"
],
"length": 102,
"sequence": "SVAEFLKGLPSHDENNFANFHTDNGNRTCVKRPSVYLPTKDYPSEQIIVTEKTTILLRYLHQQWDKKNADRKREFLSTNGDSQDDASTVRSKRPRLDLNNSL",
"proteome": "UP000670152",
"gene": "Dda1",
"go_terms": [
{
"identifier": "GO:0032434",
"name": "regulation of proteasomal ubiquitin-dependent protein catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1d6e8dbbb7ae91472307954d71454bcbffaf6abf",
"counters": {
"domain_architectures": 2314,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2314
}
}
}