"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A836FP47"	"{'domain_architectures': 2314, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2314}"	"['Functions as a component of numerous distinct DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. In the DCX complexes, acts as a scaffolding subunit required to stabilize the complex']"	"Dda1"	"[{'identifier': 'GO:0032434', 'name': 'regulation of proteasomal ubiquitin-dependent protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A836FP47_9HYME"	"1d6e8dbbb7ae91472307954d71454bcbffaf6abf"	True	False	True	102	"DET1- and DDB1-associated protein 1"	3	"UP000670152"	"SVAEFLKGLPSHDENNFANFHTDNGNRTCVKRPSVYLPTKDYPSEQIIVTEKTTILLRYLHQQWDKKNADRKREFLSTNGDSQDDASTVRSKRPRLDLNNSL"	"unreviewed"	"{'taxId': '230685', 'scientificName': 'Acromyrmex heyeri', 'fullName': 'Acromyrmex heyeri'}"
