General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A804NDN7",
        "id": "A0A804NDN7_MAIZE",
        "source_organism": {
            "taxId": "4577",
            "scientificName": "Zea mays",
            "fullName": "Zea mays (Maize)"
        },
        "name": "Histidine-containing phosphotransfer protein",
        "description": [
            "Functions as a two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay. Functions as a positive regulator of the cytokinin signaling pathway. May play a regulatory role in salt and drought tolerance during plant development"
        ],
        "length": 117,
        "sequence": "MDYSNLRRQAASMKKTLFDQGYLDEQFCQVEDLQDEASPNFAEEVVTLFFKDSARLISNAEQALEKYPKDFNRWDAYMQQLKGSCSSIGASRMKSECVSFRDYCGQGNVEGSVSLAA",
        "proteome": "UP000007305",
        "gene": "LOC100281022",
        "go_terms": [
            {
                "identifier": "GO:0000160",
                "name": "phosphorelay signal transduction system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009927",
                "name": "histidine phosphotransfer kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043424",
                "name": "protein histidine kinase binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "df226663ebfa12e475010cdf2e8d72057cf0a547",
        "counters": {
            "domain_architectures": 17510,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17510
        }
    }
}