"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A804NDN7"	"{'domain_architectures': 14050, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 14050}"	"['Functions as a two-component phosphorelay mediators between cytokinin sensor histidine kinases and response regulators (B-type ARRs). Plays an important role in propagating cytokinin signal transduction through the multistep His-to-Asp phosphorelay. Functions as a positive regulator of the cytokinin signaling pathway. May play a regulatory role in salt and drought tolerance during plant development']"	"LOC100281022"	"[{'identifier': 'GO:0000160', 'name': 'phosphorelay signal transduction system', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009927', 'name': 'histidine phosphotransfer kinase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0043424', 'name': 'protein histidine kinase binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A804NDN7_MAIZE"	"df226663ebfa12e475010cdf2e8d72057cf0a547"	True	False	117	"Histidine-containing phosphotransfer protein"	1	"UP000007305"	"MDYSNLRRQAASMKKTLFDQGYLDEQFCQVEDLQDEASPNFAEEVVTLFFKDSARLISNAEQALEKYPKDFNRWDAYMQQLKGSCSSIGASRMKSECVSFRDYCGQGNVEGSVSLAA"	"unreviewed"	"{'taxId': '4577', 'scientificName': 'Zea mays', 'fullName': 'Zea mays (Maize)'}"
