GET /api/protein/UniProt/A0A7U9DKB5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7U9DKB5",
"id": "A0A7U9DKB5_STRLI",
"source_organism": {
"taxId": "1200984",
"scientificName": "Streptomyces lividans 1326",
"fullName": "Streptomyces lividans 1326"
},
"name": "threonine ammonia-lyase",
"description": [
"Catalyzes the anaerobic formation of alpha-ketobutyrate and ammonia from threonine in a two-step reaction. The first step involved a dehydration of threonine and a production of enamine intermediates (aminocrotonate), which tautomerizes to its imine form (iminobutyrate). Both intermediates are unstable and short-lived. The second step is the nonenzymatic hydrolysis of the enamine/imine intermediates to form 2-ketobutyrate and free ammonia. In the low water environment of the cell, the second step is accelerated by RidA"
],
"length": 325,
"sequence": "MTTTTPPVTLDDVRSAAARIKGVAHRTPVLRSRTLDALVGAEVHLKCENQQRVGAFKFRGAYNAASRLTPEQLARGIAAYSSGNHAQAVALAARELGTTAVIVMPEDAPPSKRDATAGYGAEIVTYDRYTGDRVAVAEALAADRGLTLIPPYEHPHVIAGQGTAALELVEETGELDALVAPVGGGGLIAGSATAVKALHPGMRVIGVEPEAGDDTRRSLAAGRRVSVPVPRTIADGQALPTPGELTFSLNRRLLDGIVLVSDDEIRDAMRFAFERLKTVLEPSGATPLAALMNGRIDALPRRVGVILSGGNVDAARFAELCGAPR",
"proteome": null,
"gene": "SLI_0805",
"go_terms": [
{
"identifier": "GO:0030170",
"name": "pyridoxal phosphate binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006520",
"name": "amino acid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8bc361cd7c1d6142f8798dedc919bc5496ed8194",
"counters": {
"domain_architectures": 181949,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 181949
}
}
}