"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7U9DKB5"	"{'domain_architectures': 181949, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 181949}"	"['Catalyzes the anaerobic formation of alpha-ketobutyrate and ammonia from threonine in a two-step reaction. The first step involved a dehydration of threonine and a production of enamine intermediates (aminocrotonate), which tautomerizes to its imine form (iminobutyrate). Both intermediates are unstable and short-lived. The second step is the nonenzymatic hydrolysis of the enamine/imine intermediates to form 2-ketobutyrate and free ammonia. In the low water environment of the cell, the second step is accelerated by RidA']"	"SLI_0805"	"[{'identifier': 'GO:0030170', 'name': 'pyridoxal phosphate binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006520', 'name': 'amino acid metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A7U9DKB5_STRLI"	"8bc361cd7c1d6142f8798dedc919bc5496ed8194"	True	False	False	325	"threonine ammonia-lyase"	3	""	"MTTTTPPVTLDDVRSAAARIKGVAHRTPVLRSRTLDALVGAEVHLKCENQQRVGAFKFRGAYNAASRLTPEQLARGIAAYSSGNHAQAVALAARELGTTAVIVMPEDAPPSKRDATAGYGAEIVTYDRYTGDRVAVAEALAADRGLTLIPPYEHPHVIAGQGTAALELVEETGELDALVAPVGGGGLIAGSATAVKALHPGMRVIGVEPEAGDDTRRSLAAGRRVSVPVPRTIADGQALPTPGELTFSLNRRLLDGIVLVSDDEIRDAMRFAFERLKTVLEPSGATPLAALMNGRIDALPRRVGVILSGGNVDAARFAELCGAPR"	"unreviewed"	"{'taxId': '1200984', 'scientificName': 'Streptomyces lividans 1326', 'fullName': 'Streptomyces lividans 1326'}"
