GET /api/protein/UniProt/A0A7N4P5D7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7N4P5D7",
        "id": "A0A7N4P5D7_SARHA",
        "source_organism": {
            "taxId": "9305",
            "scientificName": "Sarcophilus harrisii",
            "fullName": "Sarcophilus harrisii (Tasmanian devil)"
        },
        "name": "Rho GTPase-activating protein 10",
        "description": [
            "GTPase-activating protein that catalyzes the conversion of active GTP-bound Rho GTPases to their inactive GDP-bound form, thus suppressing various Rho GTPase-mediated cellular processes. Also converts Cdc42 to an inactive GDP-bound state. Essential for PTKB2 regulation of cytoskeletal organization via Rho family GTPases. Inhibits PAK2 proteolytic fragment PAK-2p34 kinase activity and changes its localization from the nucleus to the perinuclear region. Stabilizes PAK-2p34 thereby increasing stimulation of cell death. Associates with MICAL1 on the endosomal membrane to promote Rab8-Rab10-dependent tubule extension. After dissociation with MICAL1, recruits WDR44 which connects the endoplasmic reticulum (ER) with the endosomal tubule, thereby participating in the export of a subset of neosynthesized proteins"
        ],
        "length": 785,
        "sequence": "MGLQPLEFSDCYLDSPWFRERIRAHEAELEKTNKFIKELLKDGKNLIAATKNLSLAQRKFAHSLRDFKFEFIGDAETDDERCIDASLREFSNFLRNLEEQREIMALSVTETLIKPLEKFRKEKLGAVKEEKKKFDKETEKNYSLLDKHLNLSAKKKDAHLQEADIQVEQNRKHFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQKTRNRFEGTRSEVEDLMNKIRQNPKEHKRASQFAVEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKFTMIPFEHRSGGKIGDGDVFSLKECTKRHTDSIDRRFCFDVEAADRPGIPMTMQAFSEEERKQWMEALGGKEALLPSLNRANLRREGGAQLDKIGFTILRKCIRAVETRGINDQGLYRVVGVSSKVQRLLSVLMDAKTCNEVDLENSLDWEVKTITSALKQYLRSLPEPLMTYDLHGEFIIPAKSGSPESRVNAIHFLVHRLPEKNKEMLDILVKHLTNVSNHAKQNLMTVANLGVVFGPTLMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTVPDATLPEPISMSTSPPNAPPRQSKRQGQRNKRPVAVYNLCLELEDADNPSPPKEDTPTGSLDSLSSHSPTPATLSSSPGPEKNHLLTDGGELADWASNHPSQARPPMVQWLNPQSPSSLSAHPAAAPSSPVSSSFCFSSPAVMADKPAESVVSRKARAVYPCEAEHSSELSFEIGAVFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL",
        "proteome": "UP000007648",
        "gene": "ARHGAP10",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0007165",
                "name": "signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005096",
                "name": "GTPase activator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4b65fd57722a4c9517b19c3bc83016a3a4f3979d",
        "counters": {
            "domain_architectures": 3698,
            "entries": 33,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 7,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 4,
                "ssf": 4,
                "pfam": 4,
                "profile": 3,
                "smart": 3,
                "cdd": 3,
                "panther": 1,
                "interpro": 11
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3698
        }
    }
}