General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7M6UW30",
        "id": "A0A7M6UW30_NASVI",
        "source_organism": {
            "taxId": "7425",
            "scientificName": "Nasonia vitripennis",
            "fullName": "Nasonia vitripennis (Parasitic wasp)"
        },
        "name": "SOSS complex subunit A homolog",
        "description": [
            "Component of the integrator complex, a multiprotein complex that terminates RNA polymerase II (Pol II) transcription in the promoter-proximal region of genes. The integrator complex provides a quality checkpoint during transcription elongation by driving premature transcription termination of transcripts that are unfavorably configured for transcriptional elongation: the complex terminates transcription by (1) catalyzing dephosphorylation of the C-terminal domain (CTD) of Pol II subunit Polr2A/Rbp1 and Spt5, and (2) degrading the exiting nascent RNA transcript via endonuclease activity. The integrator complex is also involved in the 3'-end processing of the U7 snRNA, and also the spliceosomal snRNAs U1, U2, U4 and U5"
        ],
        "length": 411,
        "sequence": "MAILTEPQDASKHYRDLTLVNRDGLTVILAHLNQMVLEKYLRLNDLAKSQLLWLLREMIRTSVTNVDNLCLSLLRHAAGGDISQRNIFLIDALLDIFQENRSWLDKFPFLVASVIYTYLRLIEDHSASHLTNLRQKEITFIVSLIRERITDCLVIGRDLVRLLQNVARIPEFETLWKDLLLNPKSLNPNFTGILQLLQTRTSRRFLQSRLTPDMERKLVFLTSTVRFGNHKRYQEWFQRQYLATPESQTLRCDLIRFIVGVIHPTNELLCSDIIPRWAVIGWLFTTCTLPVAASNAKLALFYDWLFFEPDKDNIMNIEPAILVMHNSMRSHPAVTATLLDFLCRIIPNFYPTLEDKVKSGIFSSLRQILEKRVLPSLYPLFDSPKLDRELRTKIRETFKEFCLPPNADIDY",
        "proteome": "UP000002358",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "de2807dd68e1a2c8e5fd507811b0c7c78176e475",
        "counters": {
            "domain_architectures": 950,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 950
        }
    }
}