GET /api/protein/UniProt/A0A7M4EU20/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7M4EU20",
"id": "A0A7M4EU20_CROPO",
"source_organism": {
"taxId": "8502",
"scientificName": "Crocodylus porosus",
"fullName": "Crocodylus porosus (Saltwater crocodile)"
},
"name": "DnaJ homolog subfamily C member 9",
"description": [
"Acts as a dual histone chaperone and heat shock co-chaperone. As a histone chaperone, forms a co-chaperone complex with MCM2 and histone H3-H4 heterodimers; and may thereby assist MCM2 in histone H3-H4 heterodimer recognition and facilitate the assembly of histones into nucleosomes. May also act as a histone co-chaperone together with TONSL. May recruit histone chaperones ASF1A, NASP and SPT2 to histone H3-H4 heterodimers. Also plays a role as co-chaperone of the HSP70 family of molecular chaperone proteins, such as HSPA1A, HSPA1B and HSPA8. As a co-chaperone, may play a role in the recruitment of HSP70-type molecular chaperone machinery to histone H3-H4 substrates, thereby maintaining the histone structural integrity. Exhibits activity to assemble histones onto DNA in vitro"
],
"length": 248,
"sequence": "MGLLEQCEAAFGSADLYCVLGVRRHASADEIRRGYRKASLRVHPDRAAAERRGEATQHFQVLGRAYAVLSDPGQRAVYDEQGLVDEESDARSQDRDWAEYWRLLFKKITVKDIQDFEKKYKGSEEELTDIKSAYKDFKGDMDRIMESVLCVDYTDEPRIRKIIQQAIDSGEVPSYKAFIKEAKQKMDARKRRAEEEAKEAEKSREELGLGEGEDDLKALIQRQSPHLHFLHSPWNTGQAILKSQCLYE",
"proteome": "UP000594220",
"gene": "DNAJC9",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f884952723454f9b46b58c9d9a58468e2a30d78b",
"counters": {
"domain_architectures": 4003,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"cdd": 1,
"pfam": 2,
"profile": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4003
}
}
}