"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7M4EU20"	"{'domain_architectures': 3539, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'cdd': 1, 'pfam': 2, 'profile': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3539}"	"['Acts as a dual histone chaperone and heat shock co-chaperone. As a histone chaperone, forms a co-chaperone complex with MCM2 and histone H3-H4 heterodimers; and may thereby assist MCM2 in histone H3-H4 heterodimer recognition and facilitate the assembly of histones into nucleosomes. May also act as a histone co-chaperone together with TONSL. May recruit histone chaperones ASF1A, NASP and SPT2 to histone H3-H4 heterodimers. Also plays a role as co-chaperone of the HSP70 family of molecular chaperone proteins, such as HSPA1A, HSPA1B and HSPA8. As a co-chaperone, may play a role in the recruitment of HSP70-type molecular chaperone machinery to histone H3-H4 substrates, thereby maintaining the histone structural integrity. Exhibits activity to assemble histones onto DNA in vitro']"	"DNAJC9"	""	"A0A7M4EU20_CROPO"	"f884952723454f9b46b58c9d9a58468e2a30d78b"	True	False	248	"DnaJ homolog subfamily C member 9"	4	"UP000594220"	"MGLLEQCEAAFGSADLYCVLGVRRHASADEIRRGYRKASLRVHPDRAAAERRGEATQHFQVLGRAYAVLSDPGQRAVYDEQGLVDEESDARSQDRDWAEYWRLLFKKITVKDIQDFEKKYKGSEEELTDIKSAYKDFKGDMDRIMESVLCVDYTDEPRIRKIIQQAIDSGEVPSYKAFIKEAKQKMDARKRRAEEEAKEAEKSREELGLGEGEDDLKALIQRQSPHLHFLHSPWNTGQAILKSQCLYE"	"unreviewed"	"{'taxId': '8502', 'scientificName': 'Crocodylus porosus', 'fullName': 'Crocodylus porosus (Saltwater crocodile)'}"