GET /api/protein/UniProt/A0A7L9FIT8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7L9FIT8",
"id": "A0A7L9FIT8_9CREN",
"source_organism": {
"taxId": "2776706",
"scientificName": "Infirmifilum lucidum",
"fullName": "Infirmifilum lucidum"
},
"name": "Phosphomevalonate dehydratase small subunit",
"description": [
"Component of a hydro-lyase that catalyzes the dehydration of mevalonate 5-phosphate (MVA5P) to form trans-anhydromevalonate 5-phosphate (tAHMP). Involved in the archaeal mevalonate (MVA) pathway, which provides fundamental precursors for isoprenoid biosynthesis, such as isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP)"
],
"length": 135,
"sequence": "MRIAGRPVSEGVARGQVLLSREPITFFGGVDPKTSEVVEPSHPLKGEKLAGKILVFPHSKGSTVGSYVLLRMAKRGVAPAGVVTVRPDEVVIIGCIISGIPSMTGIDEASLGKIRPGSLAEIRVGRSHAELVLYE",
"proteome": "UP000594121",
"gene": "IG193_03585",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a0e596b48256e65aaca79d8589b8b4ecbf6fa88b",
"counters": {
"domain_architectures": 1671,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"pirsf": 1,
"hamap": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1671
}
}
}