General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7L9FIT8",
        "id": "A0A7L9FIT8_9CREN",
        "source_organism": {
            "taxId": "2776706",
            "scientificName": "Infirmifilum lucidum",
            "fullName": "Infirmifilum lucidum"
        },
        "name": "Phosphomevalonate dehydratase small subunit",
        "description": [
            "Component of a hydro-lyase that catalyzes the dehydration of mevalonate 5-phosphate (MVA5P) to form trans-anhydromevalonate 5-phosphate (tAHMP). Involved in the archaeal mevalonate (MVA) pathway, which provides fundamental precursors for isoprenoid biosynthesis, such as isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP)"
        ],
        "length": 135,
        "sequence": "MRIAGRPVSEGVARGQVLLSREPITFFGGVDPKTSEVVEPSHPLKGEKLAGKILVFPHSKGSTVGSYVLLRMAKRGVAPAGVVTVRPDEVVIIGCIISGIPSMTGIDEASLGKIRPGSLAEIRVGRSHAELVLYE",
        "proteome": "UP000594121",
        "gene": "IG193_03585",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a0e596b48256e65aaca79d8589b8b4ecbf6fa88b",
        "counters": {
            "domain_architectures": 1671,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "pirsf": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1671
        }
    }
}