"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7L9FIT8"	"{'domain_architectures': 1152, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'pirsf': 1, 'hamap': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1152}"	"['Component of a hydro-lyase that catalyzes the dehydration of mevalonate 5-phosphate (MVA5P) to form trans-anhydromevalonate 5-phosphate (tAHMP). Involved in the archaeal mevalonate (MVA) pathway, which provides fundamental precursors for isoprenoid biosynthesis, such as isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP)']"	"IG193_03585"	""	"A0A7L9FIT8_9CREN"	"a0e596b48256e65aaca79d8589b8b4ecbf6fa88b"	True	False	135	"Phosphomevalonate dehydratase small subunit"	3	"UP000594121"	"MRIAGRPVSEGVARGQVLLSREPITFFGGVDPKTSEVVEPSHPLKGEKLAGKILVFPHSKGSTVGSYVLLRMAKRGVAPAGVVTVRPDEVVIIGCIISGIPSMTGIDEASLGKIRPGSLAEIRVGRSHAELVLYE"	"unreviewed"	"{'taxId': '2776706', 'scientificName': 'Infirmifilum lucidum', 'fullName': 'Infirmifilum lucidum'}"