General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7K7NRH7",
        "id": "A0A7K7NRH7_HALAL",
        "source_organism": {
            "taxId": "8969",
            "scientificName": "Haliaeetus albicilla",
            "fullName": "Haliaeetus albicilla (White-tailed sea-eagle)"
        },
        "name": "SAM domain-containing protein SAMSN-1",
        "description": [
            "Negative regulator of B-cell activation. Down-regulates cell proliferation (in vitro). Promotes RAC1-dependent membrane ruffle formation and reorganization of the actin cytoskeleton. Regulates cell spreading and cell polarization. Stimulates HDAC1 activity. Regulates LYN activity by modulating its tyrosine phosphorylation"
        ],
        "length": 371,
        "sequence": "QTKTSSVSQGLSSLFLQRTSSFGSFDRFRHHSISKADDAAEICELETISDIGDAVQTKAANNGGSLGKKMRAISLTMKKKMGKKYIKALSEEMNEEGKDESDPGGGIHTEKVSLKASDSMESLYSLNSGQSSSSGVTSCSDGTSNRDSLRFDDEVPYSGPFCGRAKVHTDFTPSPYDTDSLKIRKGDIIDIICKTPMGIWTGMLNNKVGNFKFIYVDIILEEEAAPRKVKLHRGSKRTKPKTLQDLLDCVHLQEYASTLLLNGYETLEDLKDLQESHLIELNISNPEDRARLLSAIENLQDYDIEQQQKSEGGQEMLSLSPHHGFDKSQLNDCPRDSGCYISSENSDNGKEEIDPETLSDMVQSVTITESN",
        "proteome": "UP000585422",
        "gene": "Samsn1",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4f7b16ca4535812da860b07d38f2dbf8ab41f3f1",
        "counters": {
            "domain_architectures": 576,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 2,
                "cathgene3d": 2,
                "profile": 2,
                "smart": 2,
                "cdd": 2,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 576
        }
    }
}