General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8FQR6",
        "id": "A0A7J8FQR6_MOLMO",
        "source_organism": {
            "taxId": "27622",
            "scientificName": "Molossus molossus",
            "fullName": "Molossus molossus (Pallas' mastiff bat)"
        },
        "name": "Ermin",
        "description": [
            "Plays a role in cytoskeletal rearrangements during the late wrapping and/or compaction phases of myelinogenesis as well as in maintenance and stability of myelin sheath in the adult. May play an important role in late-stage oligodendroglia maturation, myelin/Ranvier node formation during CNS development, and in the maintenance and plasticity of related structures in the mature CNS"
        ],
        "length": 255,
        "sequence": "MTDVPVTFSQVECNGNTPPENRNPPITKTNEEISDVDGTPPYYRVEPSLKDLPTEGKQEKSEKLPGKMLLNCSMDEKILKETSVDEMTFREGHPWKKIPLSSSHLEISRQKERIAEQPLEERGDGGRKNEAYQATEIEWLGFRKPSQVDVFHDEEQEVWDEEIHSEDDDEDEVQVIELKEKSEEGSHLKEGGNPGEDSPLSSPGSQPVSPEQSAFGKKSDISKNTSSRYNTISYRKIRKGNTKQRIDEFESMMHL",
        "proteome": "UP000550707",
        "gene": "HJG59_004625",
        "go_terms": [
            {
                "identifier": "GO:0003779",
                "name": "actin binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051015",
                "name": "actin filament binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007015",
                "name": "actin filament organization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008360",
                "name": "regulation of cell shape",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ce8a63342a402be266dd6f3404c3de2a5434cd26",
        "counters": {
            "domain_architectures": 701,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 701
        }
    }
}