"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7J8FQR6"	"{'domain_architectures': 658, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 658}"	"['Plays a role in cytoskeletal rearrangements during the late wrapping and/or compaction phases of myelinogenesis as well as in maintenance and stability of myelin sheath in the adult. May play an important role in late-stage oligodendroglia maturation, myelin/Ranvier node formation during CNS development, and in the maintenance and plasticity of related structures in the mature CNS']"	"HJG59_004625"	"[{'identifier': 'GO:0003779', 'name': 'actin binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051015', 'name': 'actin filament binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007015', 'name': 'actin filament organization', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008360', 'name': 'regulation of cell shape', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A7J8FQR6_MOLMO"	"ce8a63342a402be266dd6f3404c3de2a5434cd26"	True	False	255	"Ermin"	4	"UP000550707"	"MTDVPVTFSQVECNGNTPPENRNPPITKTNEEISDVDGTPPYYRVEPSLKDLPTEGKQEKSEKLPGKMLLNCSMDEKILKETSVDEMTFREGHPWKKIPLSSSHLEISRQKERIAEQPLEERGDGGRKNEAYQATEIEWLGFRKPSQVDVFHDEEQEVWDEEIHSEDDDEDEVQVIELKEKSEEGSHLKEGGNPGEDSPLSSPGSQPVSPEQSAFGKKSDISKNTSSRYNTISYRKIRKGNTKQRIDEFESMMHL"	"unreviewed"	"{'taxId': '27622', 'scientificName': 'Molossus molossus', 'fullName': ""Molossus molossus (Pallas' mastiff bat)""}"