General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J8CSS4",
        "id": "A0A7J8CSS4_MOLMO",
        "source_organism": {
            "taxId": "27622",
            "scientificName": "Molossus molossus",
            "fullName": "Molossus molossus (Pallas' mastiff bat)"
        },
        "name": "Neutrophil cytosol factor 2",
        "description": [
            "Subunit of the phagocyte NADPH oxidase complex that mediates the transfer of electrons from cytosolic NADPH to O2 to produce the superoxide anion (O2(-)). In the activated complex, electrons are first transferred from NADPH to flavin adenine dinucleotide (FAD) and subsequently transferred via two heme molecules to molecular oxygen, producing superoxide through an outer-sphere reaction. Activation of the NADPH oxidase complex is initiated by the assembly of cytosolic subunits of the NADPH oxidase complex with the core NADPH oxidase complex to form a complex at the plasma membrane or phagosomal membrane. This activation process is initiated by phosphorylation dependent binding of the cytosolic NCF1/p47-phox subunit to the C-terminus of CYBA/p22-phox"
        ],
        "length": 480,
        "sequence": "MSLAEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCVHTILENWAAAEKAFSRTINRDKHLAVAYFQRGMLYHRLQKYDSAITDLKEALTQLRGNQLIDYKILGLQFKLFACEKQKLYEPVVVPVGRLFRPNERQVAQLEKKDYLGKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETPEELQVMPGNIVFVLKKGNDNWATVIFNGQKGLVPCNYLEPVSLRIHPQQQSQEEASPESEIPDPPISSAPGRPQLPPGQKEKEESKEVKLSVPMLYTLKVHYKYTVVMETQPGLPYSQVRDMVSKKLELLPEHTKLSYRPGDSRDLVPLSEDSMKDAWGQAKNYCLTLWCEHTVGDQGFPEEPEESEKSDASGQTPEPPLKEGSRVVALFSYQAAQPEDLEFLEGDIIQVVSMVNDEWLEGTCKGKFGIFPKAFVEQAAAGLDSTPRGV",
        "proteome": "UP000550707",
        "gene": "HJG59_012864",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3ef0bd189f43de2d19ed7e2022a434a6dc6a2850",
        "counters": {
            "domain_architectures": 266,
            "entries": 29,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "smart": 3,
                "profile": 3,
                "pfam": 3,
                "cdd": 2,
                "panther": 1,
                "prints": 2,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 266
        }
    }
}