"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7J8CSS4"	"{'domain_architectures': 266, 'entries': 29, 'isoforms': 0, 'proteomes': 1, 'sets': 5, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 3, 'ssf': 3, 'smart': 3, 'profile': 3, 'pfam': 3, 'cdd': 2, 'panther': 1, 'prints': 2, 'interpro': 9}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 266}"	"['Subunit of the phagocyte NADPH oxidase complex that mediates the transfer of electrons from cytosolic NADPH to O2 to produce the superoxide anion (O2(-)). In the activated complex, electrons are first transferred from NADPH to flavin adenine dinucleotide (FAD) and subsequently transferred via two heme molecules to molecular oxygen, producing superoxide through an outer-sphere reaction. Activation of the NADPH oxidase complex is initiated by the assembly of cytosolic subunits of the NADPH oxidase complex with the core NADPH oxidase complex to form a complex at the plasma membrane or phagosomal membrane. This activation process is initiated by phosphorylation dependent binding of the cytosolic NCF1/p47-phox subunit to the C-terminus of CYBA/p22-phox']"	"HJG59_012864"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A7J8CSS4_MOLMO"	"3ef0bd189f43de2d19ed7e2022a434a6dc6a2850"	True	False	False	480	"Neutrophil cytosol factor 2"	3	"UP000550707"	"MSLAEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCVHTILENWAAAEKAFSRTINRDKHLAVAYFQRGMLYHRLQKYDSAITDLKEALTQLRGNQLIDYKILGLQFKLFACEKQKLYEPVVVPVGRLFRPNERQVAQLEKKDYLGKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETPEELQVMPGNIVFVLKKGNDNWATVIFNGQKGLVPCNYLEPVSLRIHPQQQSQEEASPESEIPDPPISSAPGRPQLPPGQKEKEESKEVKLSVPMLYTLKVHYKYTVVMETQPGLPYSQVRDMVSKKLELLPEHTKLSYRPGDSRDLVPLSEDSMKDAWGQAKNYCLTLWCEHTVGDQGFPEEPEESEKSDASGQTPEPPLKEGSRVVALFSYQAAQPEDLEFLEGDIIQVVSMVNDEWLEGTCKGKFGIFPKAFVEQAAAGLDSTPRGV"	"unreviewed"	"{'taxId': '27622', 'scientificName': 'Molossus molossus', 'fullName': ""Molossus molossus (Pallas' mastiff bat)""}"
