General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J7FHC9",
        "id": "A0A7J7FHC9_DICBM",
        "source_organism": {
            "taxId": "77932",
            "scientificName": "Diceros bicornis minor",
            "fullName": "Diceros bicornis minor (South-central black rhinoceros)"
        },
        "name": "Lysosomal membrane ascorbate-dependent ferrireductase CYB561A3",
        "description": [
            "Transmembrane reductase that uses ascorbate as an electron donor in the cytoplasm and transfers electrons across membranes to reduce iron cations Fe(3+) into Fe(2+) in the lumen of the late endosome and lysosome. Reduced iron can then be extruded from the late endosome and lysosome to the cytoplasm by divalent metal-specific transporters. It is therefore most probably involved in endosomal and lysosomal cellular iron homeostasis"
        ],
        "length": 262,
        "sequence": "MAVGWFYLSCLVLGSLGSMCILFTIYWMQYWRGGFAWDGSTYMFNWHPVLMVTGMVVFYSAASLVYRLPQSWVGPKLPWKLLHAALHLMAFILTVLGLVAVFKFHNHNKIANLYSLHSWLGITAVFLFACQWFLGFAVFLLPWAPVWLRSLLKPIHVFFGSSILSLAITSVISGINEKLFFSLKNGTNQYSHLPSEAIFANSTGVLVVVFGLLVLYILLASSWKRPEPGMLTDRQLPLQLRPGSRPFPVTYKPVAVRQPCEP",
        "proteome": "UP000551758",
        "gene": "HPG69_018951",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3a3c8a2abb46469df3e9f07ea0ffd1238f32eaca",
        "counters": {
            "domain_architectures": 15320,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "profile": 1,
                "smart": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15320
        }
    }
}