"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7J7FHC9"	"{'domain_architectures': 15320, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'profile': 1, 'smart': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 15320}"	"['Transmembrane reductase that uses ascorbate as an electron donor in the cytoplasm and transfers electrons across membranes to reduce iron cations Fe(3+) into Fe(2+) in the lumen of the late endosome and lysosome. Reduced iron can then be extruded from the late endosome and lysosome to the cytoplasm by divalent metal-specific transporters. It is therefore most probably involved in endosomal and lysosomal cellular iron homeostasis']"	"HPG69_018951"	"[{'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A7J7FHC9_DICBM"	"3a3c8a2abb46469df3e9f07ea0ffd1238f32eaca"	True	False	True	262	"Lysosomal membrane ascorbate-dependent ferrireductase CYB561A3"	4	"UP000551758"	"MAVGWFYLSCLVLGSLGSMCILFTIYWMQYWRGGFAWDGSTYMFNWHPVLMVTGMVVFYSAASLVYRLPQSWVGPKLPWKLLHAALHLMAFILTVLGLVAVFKFHNHNKIANLYSLHSWLGITAVFLFACQWFLGFAVFLLPWAPVWLRSLLKPIHVFFGSSILSLAITSVISGINEKLFFSLKNGTNQYSHLPSEAIFANSTGVLVVVFGLLVLYILLASSWKRPEPGMLTDRQLPLQLRPGSRPFPVTYKPVAVRQPCEP"	"unreviewed"	"{'taxId': '77932', 'scientificName': 'Diceros bicornis minor', 'fullName': 'Diceros bicornis minor (South-central black rhinoceros)'}"
