GET /api/protein/UniProt/A0A7J6CZW2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7J6CZW2",
        "id": "A0A7J6CZW2_9TELE",
        "source_organism": {
            "taxId": "369639",
            "scientificName": "Onychostoma macrolepis",
            "fullName": "Onychostoma macrolepis"
        },
        "name": "Prostacyclin synthase",
        "description": [
            "Catalyzes the biosynthesis and metabolism of eicosanoids. Catalyzes the isomerization of prostaglandin H2 to prostacyclin (= prostaglandin I2), a potent mediator of vasodilation and inhibitor of platelet aggregation. Additionally, displays dehydratase activity, toward hydroperoxyeicosatetraenoates (HPETEs), especially toward (15S)-hydroperoxy-(5Z,8Z,11Z,13E)-eicosatetraenoate (15(S)-HPETE)"
        ],
        "length": 478,
        "sequence": "MMWTALLLLGLAGLLLYARRMRRRNEPPLDKGIIPWLGHALEFGKDAAKFLTRMKQKHGDIFTVRAAGQYITVLLDSNCYDAVLSDVVSLDQTGYAQVLMKRIFSLNLPNHNPESEKKRAEMHFQGSALTQLCSSMQNYLQHLVTPSEMGLKVSEWKKDGLFDFCYSLLFKTGYLTVFGAEKNNSAALAEIYEEFRRFDKLLPKLARTTENKEEKQIASSAQEKLWKLLTPSRLDRKPEHQSWLGNYVQQLQDEGVDAETQRRAMLLQLWVTQGNAGPTAFWVLGYLLTHPEALRAVREEIQGGKHLRPEETQKNTPVFDSVLSETLRLTAAALITREVKQDKKICLSNGQQYQLRRGDRLCVFPFISPQMDPQIHQQPEMFQFDRFLNADGTEKKDFFKEGVRVKYPSVPWGTKDNLCPGRQFAVSAIKELVFTILTRFDLELCDKNAKLPLVDPSRYGFGILQPAGDLEIRYRIRS",
        "proteome": "UP000579812",
        "gene": "G5714_007284",
        "go_terms": [
            {
                "identifier": "GO:0004497",
                "name": "monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016705",
                "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a02e61ba6c64bb9a9c779746e03a6c43264a16fb",
        "counters": {
            "domain_architectures": 520850,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 520850
        }
    }
}