General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7H1MCS6",
        "id": "A0A7H1MCS6_9NEIS",
        "source_organism": {
            "taxId": "1815583",
            "scientificName": "Neisseria musculi",
            "fullName": "Neisseria musculi"
        },
        "name": "Outer membrane protein assembly factor BamE",
        "description": [
            "Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane"
        ],
        "length": 137,
        "sequence": "MNKILCPAIAVLLGLAACSSERVSHFPSYKLKVVQGNELDARAVASLQSGMSREQVQLLLGTPLLRDPFHADRWDYTFNIARNGVISEQRTLTLYFNNDRLARAEGNAIEYAVQQLQAGQSAEVQPQPQPVFRPDAQ",
        "proteome": "UP000516412",
        "gene": "bamE",
        "go_terms": [
            {
                "identifier": "GO:0019867",
                "name": "outer membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3a9b04537866358cecec3d86a9a40ea6d74d384a",
        "counters": {
            "domain_architectures": 12442,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12442
        }
    }
}