"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A7H1MCS6"	"{'domain_architectures': 12442, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'pfam': 1, 'cathgene3d': 1, 'panther': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 12442}"	"['Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane']"	"bamE"	"[{'identifier': 'GO:0019867', 'name': 'outer membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A7H1MCS6_9NEIS"	"3a9b04537866358cecec3d86a9a40ea6d74d384a"	True	False	False	137	"Outer membrane protein assembly factor BamE"	3	"UP000516412"	"MNKILCPAIAVLLGLAACSSERVSHFPSYKLKVVQGNELDARAVASLQSGMSREQVQLLLGTPLLRDPFHADRWDYTFNIARNGVISEQRTLTLYFNNDRLARAEGNAIEYAVQQLQAGQSAEVQPQPQPVFRPDAQ"	"unreviewed"	"{'taxId': '1815583', 'scientificName': 'Neisseria musculi', 'fullName': 'Neisseria musculi'}"
