GET /api/protein/UniProt/A0A714ZTY7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A714ZTY7",
"id": "A0A714ZTY7_SALTI",
"source_organism": {
"taxId": "220341",
"scientificName": "Salmonella enterica subsp. enterica serovar Typhi str. CT18",
"fullName": "Salmonella enterica subsp. enterica serovar Typhi str. CT18"
},
"name": "Acyl-CoA thioester hydrolase YciA",
"description": [
"Catalyzes the hydrolysis of the thioester bond in palmitoyl-CoA and malonyl-CoA"
],
"length": 133,
"sequence": "MTTMDNTPQGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYARCVKRGTTSISINIEVWVKKVASEPIGQRYKATEALFIYVAVDPDGKPRPLPVQG",
"proteome": null,
"gene": "yciA",
"go_terms": [
{
"identifier": "GO:0016790",
"name": "thiolester hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "83515c55570f61cfb5e878ab31f7d2777385a86e",
"counters": {
"domain_architectures": 114854,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"profile": 1,
"ssf": 1,
"pfam": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 114854
}
}
}