"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A714ZTY7"	"{'domain_architectures': 114854, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'profile': 1, 'ssf': 1, 'pfam': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 114854}"	"['Catalyzes the hydrolysis of the thioester bond in palmitoyl-CoA and malonyl-CoA']"	"yciA"	"[{'identifier': 'GO:0016790', 'name': 'thiolester hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A714ZTY7_SALTI"	"83515c55570f61cfb5e878ab31f7d2777385a86e"	True	False	False	133	"Acyl-CoA thioester hydrolase YciA"	3	""	"MTTMDNTPQGELVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYARCVKRGTTSISINIEVWVKKVASEPIGQRYKATEALFIYVAVDPDGKPRPLPVQG"	"unreviewed"	"{'taxId': '220341', 'scientificName': 'Salmonella enterica subsp. enterica serovar Typhi str. CT18', 'fullName': 'Salmonella enterica subsp. enterica serovar Typhi str. CT18'}"
